DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and ceh-1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_508796.2 Gene:ceh-1 / 191614 WormBaseID:WBGene00000428 Length:171 Species:Caenorhabditis elegans


Alignment Length:110 Identity:68/110 - (61%)
Similarity:77/110 - (70%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 DGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGS---KPRRARTAFTYEQLVSLENKFKTTRYLS 571
            :|..::|..||.:...........||...||..|   |.|||||||||||||:|||||||:||||
 Worm     2 NGFRVEDLLSEREKDSNSDEATHQKSPADGGKSSRKLKMRRARTAFTYEQLVALENKFKTSRYLS 66

  Fly   572 VCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPP 616
            |.||||||:.|.|:|||||||||||||||||.|||.|.|:|..||
 Worm    67 VVERLNLAIQLQLSETQVKIWFQNRRTKWKKHNPGQDANTPQTPP 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 44/51 (86%)
ceh-1NP_508796.2 COG5576 2..118 CDD:227863 68/110 (62%)
Homeobox 44..96 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159657
Domainoid 1 1.000 105 1.000 Domainoid score I4181
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007326
OrthoInspector 1 1.000 - - oto17923
orthoMCL 1 0.900 - - OOG6_109243
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2564
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.670

Return to query results.
Submit another query.