DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Nkx2-6

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:186 Identity:57/186 - (30%)
Similarity:77/186 - (41%) Gaps:46/186 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 GSRNGDGKSGGGGGGGSKP-RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVK 590
            |:.:||.:.||.....::| |::|..|:..|:::||.:||..|||:..||.:||.:|.||.||||
Mouse   104 GNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTSTQVK 168

  Fly   591 IWFQNRRTKWKKQNPGMDV--------------------NSPTIPPPGGGSFGPGAYASGLLYSH 635
            |||||||.|.|.|.....:                    ..|.:.|......||        |..
Mouse   169 IWFQNRRYKSKSQRQDQTLELAGHPLAPRRVAVPVLVLDGKPCLDPDVAAFLGP--------YKA 225

  Fly   636 AVPYPPYGPYF-HPLGAHHLSHSHSXNCKMQQRLLQLFEKRGRAVAGGAGPAAGSG 690
            ..||..:|.|. .|..|.:.|...| :                |..|...|.|.||
Mouse   226 TSPYSCFGGYAGTPYDASYASRCTSAS----------------AGPGPLTPLASSG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 29/51 (57%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 6/20 (30%)
Homeobox 126..179 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.