powered by:
Protein Alignment slou and ceh-51
DIOPT Version :9
Sequence 1: | NP_001262808.1 |
Gene: | slou / 42547 |
FlyBaseID: | FBgn0002941 |
Length: | 698 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507685.1 |
Gene: | ceh-51 / 180233 |
WormBaseID: | WBGene00013583 |
Length: | 234 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 26/60 - (43%) |
Similarity: | 36/60 - (60%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 544 KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 603
|.|.|||.|:..||.:|..:|:....:.|.||..|...:.|:..|:||||||||.|.:|:
Worm 146 KRRGARTPFSDSQLYALRTRFEQCDTIKVDERRKLGAVIGLSPEQIKIWFQNRRFKLRKE 205
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.