DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and DLX5

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:178 Identity:60/178 - (33%)
Similarity:78/178 - (43%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 SDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERL 576
            |..:.|..|....:....||..|         |.|:.||.::..||.:|:.:|:.|:||::.||.
Human   113 SATNQPEKEVTEPEVRMVNGKPK---------KVRKPRTIYSSFQLAALQRRFQKTQYLALPERA 168

  Fly   577 NLALSLSLTETQVKIWFQNRRTKWKK----------QNPG----MDVNSPTIP----PPGGG--- 620
            .||.||.||:|||||||||:|:|.||          .:|.    |..|||..|    |.|..   
Human   169 ELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSL 233

  Fly   621 SFGPGAY--------ASGLLYSHAVPY-----------PPYGPYFHPL 649
            |..|.|:        ||..|.:.|..|           ||.|...|||
Human   234 SHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 29/55 (53%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567 1/4 (25%)
Homeodomain 138..194 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.