DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment slou and Lbx1

DIOPT Version :9

Sequence 1:	NP_001262808.1	Gene:	slou / 42547	FlyBaseID:	FBgn0002941	Length:	698	Species:	Drosophila melanogaster
Sequence 2:	NP_034821.2	Gene:	Lbx1 / 16814	MGIID:	104867	Length:	282	Species:	Mus musculus

Alignment Length:	142	Identity:	44/142 - (30%)
Similarity:	55/142 - (38%)	Gaps:	53/142 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly   532 DGKSG----GGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIW 592
            :|:.|    |......|.|::|||||..|:..||.:|...:|||..:|..:|..|.||..||..|
Mouse   108 EGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITW 172

  Fly   593 FQNRRTKW--------------KKQNPG--MDV----------------------------NSPT 613
            |||||.|.              ||..|.  ||:                            .||.
Mouse   173 FQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGCGRAKSRPGSPA 237

  Fly   614 IPP-----PGGG 620
            :||     ||||
Mouse   238 LPPGAPQAPGGG 249

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
slou	NP_001262808.1	Homeobox	549..601	CDD:278475	26/65 (40%)
Lbx1	NP_034821.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..36
		Homeobox	128..182	CDD:395001	26/53 (49%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	210..282		8/40 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.900