DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Hoxd4

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:112 Identity:42/112 - (37%)
Similarity:61/112 - (54%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 GSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPG 606
            |.:|:|:|||:|.:|::.||.:|...|||:...|:.:|.:|.|:|.|:||||||||.||||.:  
Mouse   149 GGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDH-- 211

  Fly   607 MDVNSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFHPLGAHH 653
                  .:|...|.|     .:|....|.|.|    |.:..|:...|
Mouse   212 ------KLPNTKGRS-----SSSSSCSSSAAP----GQHLQPMAKDH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 28/55 (51%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126
Antp-type hexapeptide 131..136
Homeodomain 153..209 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.