DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Hoxc12

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_034593.1 Gene:Hoxc12 / 15421 MGIID:96194 Length:280 Species:Mus musculus


Alignment Length:155 Identity:41/155 - (26%)
Similarity:64/155 - (41%) Gaps:30/155 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 PSGPFGHPRQWSY-------------ERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDID 515
            ||||.....::.|             ..|....:.|:.|.|..:    ||:.::.....|...:.
Mouse   129 PSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSSSL----LNEGNKSASAGDPGSLV 189

  Fly   516 DPSSETDSKKGGSRNGDGKSGGGGGG---GSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLN 577
            .|.:.          |.|.|..|...   .|:.|:.|..::..||..||.:|....:::...|..
Mouse   190 SPLNP----------GGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRE 244

  Fly   578 LALSLSLTETQVKIWFQNRRTKWKK 602
            |:..|:|::.||||||||||.|.|:
Mouse   245 LSDRLNLSDQQVKIWFQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 22/55 (40%)
Hoxc12NP_034593.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..212 18/96 (19%)
Homeodomain 213..269 CDD:459649 22/55 (40%)

Return to query results.
Submit another query.