DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Dbx1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:144 Identity:46/144 - (31%)
Similarity:61/144 - (42%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KPRRA---RTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWK---- 601
            ||||.   |..|:..|..:||..|:..:|:|..:|..||..|.|.::||||||||||.||:    
Mouse   177 KPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSKE 241

  Fly   602 ----------------KQNPGMDVNSPTIPPPGGGSFGPGAYAS---GLLYSHAVPYPPYGPYFH 647
                            |.||..|::..       |..|||....   |...::..|..|......
Mouse   242 RELLSSGGCREQTLPTKLNPHPDLSDV-------GQKGPGDEEEDNPGARLAYHAPADPRHLLEG 299

  Fly   648 PLGAHHLSHSHSXN 661
            ||.|   |.:|| :
Mouse   300 PLPA---SPAHSSS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 24/51 (47%)
Dbx1NP_001005232.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102
Homeobox 184..237 CDD:278475 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.