DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Barhl1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_476450.1 Gene:Barhl1 / 117232 RGDID:620648 Length:327 Species:Rattus norvegicus


Alignment Length:302 Identity:83/302 - (27%)
Similarity:120/302 - (39%) Gaps:62/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 DTSEELNVDGNDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSAS----------TSASSDRDA 440
            |....|.:....|.|:|.|      .|....|....::.:.|.:||          ...|:...:
  Rat    31 DCRSPLELSPRSESSSDCS------SPASPGRDCLETSTSRPGAASGPGLDSHLQPGQLSAPAQS 89

  Fly   441 ATKRLAFSVENILDPNKFTGNKLPSGPFGHPR------QWSYERDEEMQERLDDDQSEDMSAQDL 499
            .|...:|.:.:||...|......|....|.|.      :.:.:..|:.:::||...|...|..:.
  Rat    90 RTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAGEDFRDKLDKSVSSASSDSEY 154

  Fly   500 NDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKF 564
            ...::.|. :..|..|.|....                     .|||:||||||..||..||..|
  Rat   155 KVKEEGDR-EISSSRDSPPVRL---------------------KKPRKARTAFTDHQLAQLERSF 197

  Fly   565 KTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP-GMDVNSPT---------IPPPGG 619
            :..:||||.:|:.||.||:||:||||.|:||||||||:|.. |:::.:..         .|.|  
  Rat   198 ERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSP-- 260

  Fly   620 GSFGPGAYASGL-----LYSHAVPYPPYGPYFHPLGAHHLSH 656
             .|.|.:..|.|     ||.:..|..|......||....|.|
  Rat   261 -YFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILIH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 32/51 (63%)
Barhl1NP_476450.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 12/64 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 15/89 (17%)
Homeobox 182..235 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.