DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and LBX1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_006553.2 Gene:LBX1 / 10660 HGNCID:16960 Length:281 Species:Homo sapiens


Alignment Length:154 Identity:49/154 - (31%)
Similarity:60/154 - (38%) Gaps:51/154 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 DGKSG----GGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIW 592
            :|:.|    |......|.|::|||||..|:..||.:|...:|||..:|..:|..|.||..||..|
Human   108 EGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITW 172

  Fly   593 FQNRRTKW--------------KKQNPG--MDV---------------------------NSPTI 614
            |||||.|.              ||..|.  ||:                           .||.:
Human   173 FQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVL 237

  Fly   615 PPPGGGSFGPGAYASGLLYSHAVP 638
            ||  |....|||.|  |..|.|.|
Human   238 PP--GAPKAPGAGA--LQLSPASP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/65 (40%)
LBX1NP_006553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
Homeobox 128..181 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.