DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and hlx

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_004914850.1 Gene:hlx / 100488508 XenbaseID:XB-GENE-483226 Length:397 Species:Xenopus tropicalis


Alignment Length:354 Identity:79/354 - (22%)
Similarity:119/354 - (33%) Gaps:98/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 TTQASSTSALASASNSVSNASISISNSSSG----SPSGRDLSDYGFRIQLGGLAAAAAAAAATSR 375
            |:.|.|.:|...|.::....|..|::...|    ||.|.           ..|.||:......::
 Frog    23 TSGAGSGAAGFPALDTGKKPSFCIADILHGGDPESPPGS-----------SALTAASVGVIHPAQ 76

  Fly   376 -QIAAATYARSDTSEELNVDGNDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRD 439
             |.|.:.:..:..:.|          :...|....:.|....|:| |....|.|.|....|:...
 Frog    77 YQPAGSPFRPTPVTPE----------SSFHHRLSPLPPYQPHRAV-SLCTNNSSRARMHKSTQPA 130

  Fly   440 AATKRLAFSVENIL----DPNKFTGNKL----------------------PSGPFGHPRQWSYER 478
            ..:|.|.|.::.||    ||....||.|                      .:|.|..|.:...|.
 Frog   131 PCSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLISAGQQSGLPGQHMQSTAGHFFAPLEPLGEA 195

  Fly   479 DEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSD-----------IDDPSSETDSKKGGSRNGD 532
            ...:.:.   :.|:..|.|..    ||....|||.           ..|...:|..:|..     
 Frog   196 SSLLGQL---NGSQRSSVQQF----QDTFPGDGSRKLYMWGPYAVLTKDTMPQTYKRKRS----- 248

  Fly   533 GKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRR 597
                          .:|..|:..|...||.:|:..:|::..:|..||..|.||:.|||:||||||
 Frog   249 --------------WSRAVFSNLQRKGLEKRFEVQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRR 299

  Fly   598 TKWK--------KQNPGMDVNSPTIPPPG 618
            .||:        |.....:...|..|..|
 Frog   300 MKWRHSKEAQAQKDKEKEEAEKPEAPGSG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 23/51 (45%)
hlxXP_004914850.1 Homeobox 250..304 CDD:365835 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.