DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and nkx1-2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 / 100486193 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis


Alignment Length:124 Identity:70/124 - (56%)
Similarity:80/124 - (64%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP--- 605
            |||||||||||||||:||::|:::|||||||||:|||:|.||||||||||||||||||||.|   
 Frog    99 KPRRARTAFTYEQLVALESRFRSSRYLSVCERLSLALTLHLTETQVKIWFQNRRTKWKKQQPIGS 163

  Fly   606 ----GMDV-NSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFH----PLGAHHLS 655
                |..: |.||||.|   .|.|             |.|.|....|    ..||:|||
 Frog   164 LEGRGCSIQNCPTIPGP---RFTP-------------PLPNYPCATHIPHIGAGANHLS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 42/51 (82%)
nkx1-2XP_002937845.1 Homeobox 104..157 CDD:365835 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2564
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.