DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and hoxb5

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:313 Identity:70/313 - (22%)
Similarity:111/313 - (35%) Gaps:94/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 NSVSNASISISNSSSGSPSGRDLSDYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNV 393
            |..:.:|.::|.|...:......|.||:  ...|:..:.:.|||:|.....:.:...::....| 
 Frog    23 NYGTGSSSNLSGSYREAAGSMQPSAYGY--NYNGMDLSVSRAAASSSHYGDSAFPGQESRFRAN- 84

  Fly   394 DGNDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKF 458
                       .|.|...|..|..:.:.....:|:..:|||.|..                  :|
 Frog    85 -----------QSCPLATPDPLPCAKSHKDELSPTDPATSAGSSA------------------QF 120

  Fly   459 TGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDS 523
            |                     |::|.....::|:.|.                    |.|....
 Frog   121 T---------------------EVEETSASSETEESST--------------------PRSSAPP 144

  Fly   524 KKGGSRNGDGKSGGGGGG-----------------GSKPRRARTAFTYEQLVSLENKFKTTRYLS 571
            :.....:..|.:|..|..                 |...:|||||:|..|.:.||.:|...|||:
 Frog   145 RALQENSSPGAAGTDGQNPQIFPWMRKLHINHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLT 209

  Fly   572 VCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGSFGP 624
            ...|:.:|.:|.|:|.|:||||||||.||||.|....::..|    |..:|.|
 Frog   210 RRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLAT----GSSAFQP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.