DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and barx2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_001342044.1 Gene:barx2 / 100002200 ZFINID:ZDB-GENE-081120-4 Length:268 Species:Danio rerio


Alignment Length:98 Identity:45/98 - (45%)
Similarity:57/98 - (58%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 SSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSL 582
            |||:|::....|.            .||||:||.||..||:.||.||:..:|||..:||:||.||
Zfish   104 SSESDTEHCTPRL------------KKPRRSRTIFTELQLLGLEKKFQKQKYLSTPDRLDLAQSL 156

  Fly   583 SLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIP 615
            .||:.|||.|:||||.||||........:||.|
Zfish   157 GLTQLQVKTWYQNRRMKWKKMVLKGGHEAPTKP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 30/51 (59%)
barx2XP_001342044.1 Homeobox 122..175 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.