DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and barhl2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_991303.1 Gene:barhl2 / 100001699 ZFINID:ZDB-GENE-050913-153 Length:364 Species:Danio rerio


Alignment Length:338 Identity:91/338 - (26%)
Similarity:142/338 - (42%) Gaps:83/338 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 SDTSEELNVD---GNDEDSND-GSHSTPSVC------------PVDLT----------------- 416
            |.||..:|.|   |:...:.| .|.:|||.|            |:.:|                 
Zfish    20 SGTSVLMNGDFRLGDSSRTADFRSQATPSPCSEIDTVGTAPSSPISVTMEHPEPHLVQDSLQHHH 84

  Fly   417 ------RSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFT------GNKLPSGPFG 469
                  ::.:...:..|.....:..:.|.|.:   :|.:::||..:|..      ...:|| |..
Zfish    85 HHHHHSQAQSLQLSPQPHLLGQAGCAPRTATS---SFLIKDILGDSKPLAACAPYSTSVPS-PHH 145

  Fly   470 HPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDM-CDDGSDIDDPSSETDSKKGGSRNGDG 533
            .|:..|....:.::.:|:.|  |:.|..|..|..|.|: |.:|:     ..|.|.:...||:...
Zfish   146 SPKTESGTAPDGIRPKLEQD--ENRSKLDKRDDIQSDLKCLNGT-----KEEGDREISSSRDSPP 203

  Fly   534 KSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRT 598
            ..      ..|||:|||||:..||..||..|:..:||||.:|::||.:|:||:||||.|:|||||
Zfish   204 VR------SKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRT 262

  Fly   599 KWKKQNP-GMDVNSPT---------IPPP--------GGGSFGPGAYASGLLYS--HAVPYPPYG 643
            |||:|.. |:::.:..         .|.|        |.......|.|:..:||  :..|..|:.
Zfish   263 KWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGTVDSTTAAAAAAAMYSSMYRTPSTPHP 327

  Fly   644 PYFHPLGAHHLSH 656
            ....||....|.|
Zfish   328 SLQRPLVPRVLIH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 30/51 (59%)
barhl2NP_991303.1 COG5576 <190..299 CDD:227863 44/114 (39%)
Homeobox 213..265 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.