DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sp3 and 5PTASE11

DIOPT Version :10

Sequence 1:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_175182.2 Gene:5PTASE11 / 841160 AraportID:AT1G47510 Length:334 Species:Arabidopsis thaliana


Alignment Length:122 Identity:32/122 - (26%)
Similarity:45/122 - (36%) Gaps:38/122 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 NTEVRYITGGVLQRRKSKLPTLDVPRGMPRNLSESQLVQLSSKALSNMAGQFSKLGQTFKKPQAH 884
            |||:|:|...:|.|.|.|           |:|:    |.|..            |....:....|
plant   187 NTELRHIANSLLPRDKRK-----------RDLT----VWLGD------------LNYRIQDVSNH 224

  Fly   885 P-SSLAATMNPQVMRQRDSEIESGQEAEKA-VF------TLGRKHRNSNSASSTDTD 933
            | .||.......|:..:|..:   ||||:. :|      |||.|.....:..|:|.|
plant   225 PVRSLIQNHLQSVLVSKDQLL---QEAERGEIFKGYSEGTLGFKPTYKYNVGSSDYD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
5PTASE11NP_175182.2 EEP 56..325 CDD:469791 32/122 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.