DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sp3 and Inpp5d

DIOPT Version :10

Sequence 1:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_062184.2 Gene:Inpp5d / 54259 RGDID:2914 Length:1190 Species:Rattus norvegicus


Alignment Length:284 Identity:65/284 - (22%)
Similarity:106/284 - (37%) Gaps:103/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   934 EHDNSLYEPEVDSDVEI------------------AMDKSNYNENAFLPSV-------GIVMGNQ 973
            |.::::.|||.|::..:                  |.|.....||...|.|       .:....|
  Rat   107 EEEDAIDEPEEDTESVMSPPELPPRNIPVSAGPCEAKDLPLPTENPRAPEVTRLSLSETLFQRLQ 171

  Fly   974 KEDSPSSSDEIRHLEQKDSMCKTTEDVLTISITSVTDHVGLPTGLLENAPAIRPITPNPLICVEA 1038
            ..|:....:|  ||       |..:|.|:..:...:|.  |.|| ..|.|.::.:|  .|:|.|.
  Rat   172 SMDTSGLPEE--HL-------KAIQDYLSTQLMLDSDF--LKTG-SSNLPHLKKLT--SLLCKEL 222

  Fly  1039 HEAFDDREEGVKPVSSTSA------RDLSLPGLPTHP----EAN------KLKQLTSPLSKL--- 1084
            |      .|.::.:.|..:      :.|| |||...|    |||      ||.||||.||.:   
  Rat   223 H------GEVIRTLPSLESLQRLFDQQLS-PGLRPRPQVPGEANPITMVAKLSQLTSLLSSIEDK 280

  Fly  1085 --------------------------AKNIGLNLDPRKIATKTGVLSPTILSAENSPPERDPS-- 1121
                                      ::::|:   |:|:..|..|.|..::..::    ||.|  
  Rat   281 VKALLHEGSESTNRRSLIPPVTFEVKSESLGI---PQKMHLKVDVESGKLIIKKS----RDGSED 338

  Fly  1122 ---SRDHLLELWEAEKCKTKLIAL 1142
               |...:|:|.:::|...||:.|
  Rat   339 KFYSHKKILQLIKSQKFLNKLVIL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
Inpp5dNP_062184.2 SH2_SHIP 4..105 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..130 4/18 (22%)
SH3-binding 1 126..131 0/4 (0%)
INPP5c_SHIP1-INPP5D 406..712 CDD:197334
NPXY motif 1 914..917
PTZ00449 <930..>1132 CDD:185628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 946..1190
SH3-binding 2 969..974
Interaction with DAB2. /evidence=ECO:0000250 1014..1028
NPXY motif 2 1017..1020
SH3-binding 3 1038..1049
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.