powered by:
Protein Alignment CG7956 and Sh2d1b
DIOPT Version :9
Sequence 1: | NP_001036740.2 |
Gene: | CG7956 / 42545 |
FlyBaseID: | FBgn0038890 |
Length: | 1142 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038947337.1 |
Gene: | Sh2d1b / 501869 |
RGDID: | 1563935 |
Length: | 136 |
Species: | Rattus norvegicus |
Alignment Length: | 31 |
Identity: | 9/31 - (29%) |
Similarity: | 14/31 - (45%) |
Gaps: | 8/31 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 756 SAPAHLCLRLNYS--------VDEQEGYFHM 778
|.|..|||.::|. ..|:.||:.:
Rat 35 SVPGALCLCVSYKKLVYSYRIFREKHGYYRI 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166339896 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.