DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7956 and Sh2d1b

DIOPT Version :9

Sequence 1:NP_001036740.2 Gene:CG7956 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_038947337.1 Gene:Sh2d1b / 501869 RGDID:1563935 Length:136 Species:Rattus norvegicus


Alignment Length:31 Identity:9/31 - (29%)
Similarity:14/31 - (45%) Gaps:8/31 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   756 SAPAHLCLRLNYS--------VDEQEGYFHM 778
            |.|..|||.::|.        ..|:.||:.:
  Rat    35 SVPGALCLCVSYKKLVYSYRIFREKHGYYRI 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7956NP_001036740.2 Syja_N 174..413 CDD:280532
COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:289241 5/11 (45%)
Sh2d1bXP_038947337.1 SH2_SAP1 1..>77 CDD:198205 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.