DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sp3 and Sh2d1a

DIOPT Version :10

Sequence 1:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001102783.2 Gene:Sh2d1a / 501502 RGDID:1562408 Length:126 Species:Rattus norvegicus


Alignment Length:44 Identity:12/44 - (27%)
Similarity:21/44 - (47%) Gaps:1/44 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 KALSNMAGQFSKLGQTFKKPQAHPSSLAATMNPQV-MRQRDSEI 904
            :.:.|:...|.|..|....|..:|...::..:||. ..:|||:|
  Rat    78 RKVKNLISAFQKPDQGIVTPLQYPVEKSSARSPQAPTGRRDSDI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
Sh2d1aNP_001102783.2 SH2_SAP1a 2..104 CDD:198263 6/25 (24%)
Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 67..92 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..126 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.