| Sequence 1: | NP_001036740.2 | Gene: | sp3 / 42545 | FlyBaseID: | FBgn0038890 | Length: | 1142 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102783.2 | Gene: | Sh2d1a / 501502 | RGDID: | 1562408 | Length: | 126 | Species: | Rattus norvegicus |
| Alignment Length: | 44 | Identity: | 12/44 - (27%) |
|---|---|---|---|
| Similarity: | 21/44 - (47%) | Gaps: | 1/44 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 862 KALSNMAGQFSKLGQTFKKPQAHPSSLAATMNPQV-MRQRDSEI 904 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sp3 | NP_001036740.2 | COG5329 | <197..586 | CDD:227637 | |
| hSac2 | 663..768 | CDD:463592 | |||
| Sh2d1a | NP_001102783.2 | SH2_SAP1a | 2..104 | CDD:198263 | 6/25 (24%) |
| Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 | 67..92 | 3/13 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 100..126 | 7/22 (32%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||