DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sp3 and CG6805

DIOPT Version :10

Sequence 1:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster


Alignment Length:109 Identity:23/109 - (21%)
Similarity:42/109 - (38%) Gaps:32/109 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TSEFSIK--AGWDLSSVDDIECIGVTHGIVGVISLPNVYEPHLVVVKEASAVGVLYPPHLVYKIK 87
            |:::::|  ..|         |..:.|.:..     |:| |.:.:    ||..:.|..|:.|.:.
  Fly   254 TNDYNLKRRPAW---------CDRILHRVQS-----NIY-PGITL----SANQLSYQSHMDYTLS 299

  Fly    88 SICILSA-----------DDPDTDLPNCTKHTKSNQSTPTHSVS 120
            ....:||           ...|.:|...|..:.|:.:||..|:|
  Fly   300 DHKPVSATFNYKVEAANQTYTDEELHEMTHGSASSPATPNVSLS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
CG6805NP_611178.1 EEP 12..308 CDD:469791 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.