DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7956 and FIG4

DIOPT Version :9

Sequence 1:NP_001036740.2 Gene:CG7956 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster


Alignment Length:485 Identity:136/485 - (28%)
Similarity:208/485 - (42%) Gaps:120/485 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TIKNTTQQAANLATKQVKSSVGIREPRHIERRITEELHKIFDETDSFYFSFDCDITNNLQRHE-- 221
            |||:|.....|..|.|       |.|...|.|.......| |...:||||:..|:|..||.:|  
  Fly   118 TIKDTVMVRVNEVTSQ-------RPPHPHEDRYKRMFQNI-DLRSNFYFSYSYDLTRTLQYNESA 174

  Fly   222 -----AKSEESQSQP--------------------------DERFFWNKHMIRDLINLNDKTWIL 255
                 ||.:..:.:|                          .:||.||.::::.:..:..|.|:|
  Fly   175 PRYVGAKVDLDRDEPLPDWNTLTSNVDKAHERVDYAFRSDSRKRFVWNAYLLQPMEGIMLKDWLL 239

  Fly   256 PIIQGFMQVENCV-IGNECFTLALVSRRSRHRAGTRYKRRGVDEKGNCANYVETEQILSFRHHQL 319
            .:..||:. ::|: |......:.||:|||...||||:.:||.:.:|:.||.||||||:|......
  Fly   240 EVTHGFVS-QSCISIFGRHVNVCLVARRSSRFAGTRFLKRGANFQGDVANEVETEQIVSDGQRIC 303

  Fly   320 SFTQVRGSVPIYWSQPGYKYRPPPRLDRGVAET-QQAFELHFTKELETYGR-VCIVNLVE--QSG 380
            :|||:|||:|.:|||...|..|.|::...:.:. .|...|||.:.|..||. :.::|||:  :..
  Fly   304 AFTQMRGSIPSHWSQDISKMVPKPQIQLDICDPYAQTPSLHFERLLFHYGAPLIMLNLVKKRERR 368

  Fly   381 KEKTIGDAYADHVIKLNND------RLIYVTFDFHDYCR---------------------GMRFE 418
            |.::|.....::.|:..|.      |:.::.||.....|                     ||.|:
  Fly   369 KHESIISKELEYSIRYLNQFLPPPHRMKHIHFDMARQSRLSGGNVMEQLAIHAESIVQMTGMFFK 433

  Fly   419 NVSALIDAVGPEAGAMGFHWRDQRGMICNQKSVFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLG 483
                   |.|.|.|.              |..:.|.||:|||||||..|.||||..|..||.:||
  Fly   434 -------AAGSEPGL--------------QTGIVRTNCVDCLDRTNSAQFAIGKCALGHQLERLG 477

  Fly   484 LSPPYTPIPEQLKSPFMV-----------LWANNGDIISRQYAGTNALK--GDYTRTGERKISGM 535
            .          :||..:.           |:..:||.::.||.|:..:.  ..|.:|......| 
  Fly   478 F----------VKSAKLEFDSDCVTMLENLYEEHGDTLALQYGGSQLVHRIKTYRKTAPWGSQG- 531

  Fly   536 MKDGMNSANRFFIQNFADSFRQCIIDLMQG 565
             .|.|.:.:|::...|:|:.:|..|:|..|
  Fly   532 -SDVMQTLSRYYSNTFSDTEKQHSINLFLG 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7956NP_001036740.2 Syja_N 174..413 CDD:280532 81/282 (29%)
COG5329 <197..586 CDD:227637 125/447 (28%)
hSac2 663..768 CDD:289241
FIG4NP_608841.1 COG5329 19..599 CDD:227637 136/485 (28%)
Syja_N 85..407 CDD:280532 87/297 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.