DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sp3 and CG9784

DIOPT Version :10

Sequence 1:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster


Alignment Length:79 Identity:21/79 - (26%)
Similarity:32/79 - (40%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 EIAMDKSNYNENAFLPSV---GI----------VMGNQKEDSPSSSDEIRHLEQKDSMCKTTEDV 1000
            ::.:||.....||.||.:   |:          |:|..||| |.:......|...|.:...||.:
  Fly    58 DVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKED-PWTHKAKELLRNYDYVAVKTEQM 121

  Fly  1001 --LTISITSVTDHV 1012
              |.:|:.....||
  Fly   122 QGLLLSMFVRRQHV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 21/79 (27%)
SKICH 352..>415 CDD:465482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.