DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and BARX2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_003649.2 Gene:BARX2 / 8538 HGNCID:956 Length:279 Species:Homo sapiens


Alignment Length:221 Identity:72/221 - (32%)
Similarity:98/221 - (44%) Gaps:28/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLR 166
            ||||.........:.....|:|.:|..|...||      |.|....:|...|....|..|...||
Human    10 SSPGQLKAARRRYKTFMIDEILSKETCDYFEKL------SLYSVCPSLVVRPKPLHSCTGSPSLR 68

  Fly   167 VPP-----QRTP-----LTWALPPLHHAALAHQAVKDRLAAAFPIARRI--GHPYQNRTPPKRKK 219
            ..|     .|.|     |..|.|.:..|...|| |.:.::|..|....:  ......:..|::||
Human    69 AYPLLSVITRQPTVISHLVPATPGIAQALSCHQ-VTEAVSAEAPGGEALASSESETEQPTPRQKK 132

  Fly   220 P---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRR------Q 275
            |   ||.||.:|:..|||:|.|||||::.:|..||:.|.:|..|||||:||||.||::      |
Human   133 PRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQ 197

  Fly   276 TAEEREAERQAANRLMLSLQAEAISK 301
            .|..:...|...|.:..|.:.||..|
Human   198 EAPTKPKGRPKKNSIPTSEEIEAEEK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 44/117 (38%)
Homeobox 220..273 CDD:278475 30/55 (55%)
BARX2NP_003649.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..137 5/26 (19%)
Homeobox 136..189 CDD:306543 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..279 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.