DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and HDG11

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_177479.1 Gene:HDG11 / 843671 AraportID:AT1G73360 Length:722 Species:Arabidopsis thaliana


Alignment Length:91 Identity:27/91 - (29%)
Similarity:42/91 - (46%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 HPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 271
            |.:......::||.....|..|:..||..|.:..:....:|..|:|.|.:...|:|.|||||||:
plant    22 HHHDGSETDRKKKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQ 86

  Fly   272 WRRQTAEEREAERQAANRLMLSLQAE 297
            .:   |:...|:..|       |:||
plant    87 LK---AQHERADNSA-------LKAE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 27/91 (30%)
Homeobox 220..273 CDD:278475 18/52 (35%)
HDG11NP_177479.1 Homeobox 35..88 CDD:278475 18/52 (35%)
START_ArGLABRA2_like 231..456 CDD:176884
SRPBCC 517..>562 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.