DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and AtHB23

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:80 Identity:27/80 - (33%)
Similarity:36/80 - (45%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 KKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREA 282
            ||.|.:..  |:..|||.|.....|.|..:..|||.|.:...|:..||||||.   |...::.|.
plant    71 KKRRLNME--QLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRA---RSKTKQLEK 130

  Fly   283 ERQAANRLMLSLQAE 297
            :.....|...||:.|
plant   131 DYDMLKRQFESLRDE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 27/80 (34%)
Homeodomain 218..274 CDD:459649 21/55 (38%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 22/57 (39%)
HALZ 126..167 CDD:460477 5/20 (25%)

Return to query results.
Submit another query.