DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Pax4

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:156 Identity:50/156 - (32%)
Similarity:64/156 - (41%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKP------RTSFTRIQVAELEKRFHKQ 239
            ||...|...||   ||.|.|      .|:.|...|:...|      ||.|:..|...|||.|.:.
  Rat   137 LHWTQLRSPAV---LAPALP------SPHSNCEAPRGPHPGTSHRNRTIFSPGQAEALEKEFQRG 192

  Fly   240 KYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANR-LMLSLQAEAISKGF 303
            :|..|..|..||....:.:..|:.||.|||.|||||...:.|.:...|:: ||:...:..|....
  Rat   193 QYPDSVVRGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWETQMPGASQDLMVPKDSPGIISAQ 257

  Fly   304 APPSAPLGSQGGVNGAPLAALHGLQP 329
            ..|       |.|..|.|..|..|.|
  Rat   258 QSP-------GSVPSAALPVLEQLNP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 37/125 (30%)
Homeobox 220..273 CDD:278475 21/58 (36%)
Pax4NP_113987.1 PAX 5..129 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131
Homeobox 174..226 CDD:278475 20/51 (39%)
Transcription repression 278..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.