DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and HB-3

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:294 Identity:56/294 - (19%)
Similarity:82/294 - (27%) Gaps:146/294 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEDDHEHENEHGEEVEE---------QEIHVD-----VDSDSRMSC------GSGSDVDMDGGSC 49
            ||.::.:.|:.|..:|.         |::|.|     ....|..||      |.|.:..|:    
plant     6 EERNNINNNQEGLRLEMAFPQHGFMFQQLHEDNAHHLPSPTSLPSCPPHLFYGGGGNYMMN---- 66

  Fly    50 YDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSG 114
                             ||.|...:              |.||     ||...||.:::|.|:..
plant    67 -----------------RSMSFTGV--------------SDHH-----HLTQKSPTTTNNMNDQD 95

  Fly   115 EKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALP 179
            :.|||..|                                   |..|.|::              
plant    96 QVGEEDNL-----------------------------------SDDGSHMM-------------- 111

  Fly   180 PLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLAS 244
                                     :|          .||.|.:..  ||..|||.|.....|..
plant   112 -------------------------LG----------EKKKRLNLE--QVRALEKSFELGNKLEP 139

  Fly   245 AERAALARGLKMTDAQVKTWFQNRRTKWRRQTAE 278
            ..:..||:.|.:...|:..||||||.:|:.:..|
plant   140 ERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 23/83 (28%)
Homeobox 220..273 CDD:278475 18/52 (35%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 20/54 (37%)
HALZ 170..208 CDD:280364 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.