DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Tlx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001165596.1 Gene:Tlx2 / 680117 RGDID:1595506 Length:284 Species:Rattus norvegicus


Alignment Length:294 Identity:131/294 - (44%)
Similarity:153/294 - (52%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLAT 136
            |.:.|.|.::||.|                ..||........|:...|........|        
  Rat    15 EPISFGIDQILSGP----------------EPPGGGLGPGQVGQSQGESAAFSSGFH-------- 55

  Fly   137 SIANSTYGSAAALYSYPHLYPSAAG-GHVLRVPPQRTPLTWALPPLHHAALA------------- 187
              ..|.|..|.:|.|.|.  .|..| |.|:|||..| |:  .:||...||.|             
  Rat    56 --GTSGYAPAGSLASLPR--GSGVGPGGVIRVPAHR-PV--PVPPPSGAAPAVAGPSGLGGPGGL 113

  Fly   188 -----------HQAVKDRLAAA---FPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHK 238
                       .:..||||.||   |...||||||||||||||||||||||:|.||.|||:||.:
  Rat   114 AGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLR 178

  Fly   239 QKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGF 303
            |||||||||||||:.|:|||||||||||||||||||||||||||||..|.||:|.||.:|:.:..
  Rat   179 QKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPL 243

  Fly   304 APPSAPLGSQGGVNGAPLAALHGLQPWAEASHAA 337
            .||..|  ....::.:.|.||..||||||.:..|
  Rat   244 RPPLPP--DPLCLHNSSLFALQNLQPWAEDNKVA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 86/121 (71%)
Homeobox 220..273 CDD:278475 43/52 (83%)
Tlx2NP_001165596.1 Homeobox 160..213 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10725
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3708
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm44573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45921
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.