DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:261 Identity:81/261 - (31%)
Similarity:109/261 - (41%) Gaps:58/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLR 166
            ||||.........:.....|:|.:|..|...||      |.|....:|...|....|..|...||
  Rat    10 SSPGQLKAARRRYKTFMIDEILSKETCDYFEKL------SLYSVCPSLVVRPKPLHSCTGSPSLR 68

  Fly   167 VPP-------QRTPLTWALP------PLH--HAALAHQAVKDRLAAAFPIARRIG-------HPY 209
            ..|       |.|.::..:|      |::  ||..|..|.....|||...|...|       ...
  Rat    69 AYPLLSVITRQPTVISHLVPTGPGLTPVNTRHAVAAEAAAAAAAAAAAAAAETPGGEALASSESE 133

  Fly   210 QNRTPPKRKKP---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 271
            ..:..|::|||   ||.||.:|:..|||:|.|||||::.:|..||:.|.:|..|||||:||||.|
  Rat   134 TEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMK 198

  Fly   272 WRRQ----------------------TAEEREAER----QAANRLML-SLQAEAISKGFAPPSAP 309
            |::.                      |:||.|||.    ||.::..| |||.:...:....|.|.
  Rat   199 WKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQEQLGSLQGQEEPRDPQEPKAC 263

  Fly   310 L 310
            |
  Rat   264 L 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 54/152 (36%)
Homeobox 220..273 CDD:278475 30/55 (55%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.