DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barhl2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_075245.1 Gene:Barhl2 / 65050 RGDID:620726 Length:384 Species:Rattus norvegicus


Alignment Length:411 Identity:101/411 - (24%)
Similarity:134/411 - (32%) Gaps:186/411 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GSGSDVDMDGG-SCYDESETPLSESLQSEQTRSSSSE--------NLPFSISRLLSKPFETSHHH 92
            ||||...|:|. ....|:.|   ...:|:.|.|..||        :.|.|::....:|       
  Rat    22 GSGSPGMMNGDFRSLGEART---TDFRSQATPSPCSEIDTVGTAPSSPISVTLEPPEP------- 76

  Fly    93 HNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLY- 156
                 ||::..|                    |..|                         ||: 
  Rat    77 -----HLVTDGP--------------------QHHH-------------------------HLHH 91

  Fly   157 ------PSAAGGHVLRVPPQRTPLTWALPP--------LHHAALAHQA------VKD------RL 195
                  |||.....|:..||:.|     ||        |..||.|.:.      :||      .|
  Rat    92 GQQPPPPSAPPAQSLQPSPQQQP-----PPQPQSAAQQLGSAAAAPRTSTSSFLIKDILGDSKPL 151

  Fly   196 AAAFPIARRIGHPY--------------------------------------------------- 209
            ||..|.:..:..|:                                                   
  Rat   152 AACAPYSTSVSSPHHTPKQECNAAHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREIT 216

  Fly   210 -QNRTPPKR-KKP---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRR 269
             ...:||.| |||   ||:|:..|:.:||:.|.:||||:..:|..||..|.:||.|||||:||||
  Rat   217 SSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRR 281

  Fly   270 TKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAPLAA----------- 323
            |||:||||...|...:|.|  ..:||....|..|..||. |||......|..||           
  Rat   282 TKWKRQTAVGLELLAEAGN--YSALQRMFPSPYFYHPSL-LGSMDSTTAAAAAAAMYSSMYRTPP 343

  Fly   324 ---------------LHGLQP 329
                           :|||.|
  Rat   344 APHPQLQRPLVPRVLIHGLGP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 55/174 (32%)
Homeobox 220..273 CDD:278475 29/55 (53%)
Barhl2NP_075245.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 36/176 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..237 10/82 (12%)
Homeobox 233..285 CDD:278475 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.