DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and vox

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:160 Identity:47/160 - (29%)
Similarity:67/160 - (41%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAEL 232
            |.|.||...:.|.....:......:...||:...:...||..:.....:|  .||.||..|:.:|
Zfish    70 PAQVTPRNCSSPSFSENSGYSSGYESEAAASECASVEDGHDAEKDGATRR--IRTKFTPEQIDKL 132

  Fly   233 EKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER--------------EAE 283
            ||.|:|.|||.:.||...|..|.:::.|::|||||||.|.:|:..|.|              ..:
Zfish   133 EKIFNKHKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQEMRADFLLPQMVLPPVIPVQ 197

  Fly   284 RQAANRLMLSLQAEAISKGFAPPSAPLGSQ 313
            .|..:|..|..          ||..||..|
Zfish   198 YQCYDRQRLPF----------PPHGPLVQQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 42/132 (32%)
Homeobox 220..273 CDD:278475 26/52 (50%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 36/113 (32%)
Homeobox 121..173 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.