DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and lbx2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:304 Identity:81/304 - (26%)
Similarity:119/304 - (39%) Gaps:92/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SGSDVDMDGGSCYDES-----ETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNN 97
            :.|..||..||....|     ..||.   |.....:|:....||||..:|:||............
Zfish     2 TSSSKDMKAGSVLQSSGEERRRGPLD---QLPPPANSNKPLTPFSIEDILNKPSVKKSVGSLCPP 63

  Fly    98 HLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYK----LATSIANSTYGSAAALYSYPHLYPS 158
            .:|....|||::.|  |.......|...|  :||.|    |..|:..:..|.       .|:  :
Zfish    64 RVLEKVTGSSASRN--GISAPSSPLCALE--ELASKTFKGLEVSVIQAAEGR-------EHI--N 115

  Fly   159 AAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTS 223
            |.|                                                |.:...||:|.||:
Zfish   116 AFG------------------------------------------------QRQASKKRRKSRTA 132

  Fly   224 FTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAAN 288
            ||..|:.||||||..||||:.|:|..:|:.|.:|:|||.|||||||.|.:|. .||.:|:.::..
Zfish   133 FTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRD-LEEMKADVESLK 196

  Fly   289 RL-------MLSLQ--------AEAISKGFAP---PSAPLGSQG 314
            ::       ::|::        :..||...:|   |.:|..|:|
Zfish   197 KIPPQALQKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPSSSRG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 47/137 (34%)
Homeobox 220..273 CDD:278475 31/52 (60%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 14/46 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 11/43 (26%)
Homeobox 129..183 CDD:395001 31/53 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.