DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and BARHL1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 / 56751 HGNCID:953 Length:327 Species:Homo sapiens


Alignment Length:338 Identity:102/338 - (30%)
Similarity:140/338 - (41%) Gaps:75/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNN 95
            ||.:|..:||.....|.....:..:||..|.:||   |||..:.|.|..|   ...||.......
Human    10 DSILSHRAGSPALPKGDPLLGDCRSPLELSPRSE---SSSDCSSPASPGR---DCLETGTPRPGG 68

  Fly    96 NNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSA- 159
                 :|.||..|:.    :.|:.....|......::.:...:|:....:|.|.||... .|:| 
Human    69 -----ASGPGLDSHL----QPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSG-QPAAP 123

  Fly   160 -AGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIA-------------RRIGHPYQ 210
             .||.:                   ||.|.:..:|:|..:...|             |.|..  .
Human   124 EPGGRL-------------------AAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISS--S 167

  Fly   211 NRTPPKR-KKP---RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 271
            ..:||.| |||   ||:||..|:|:||:.|.:||||:..:|..||..|.:||.|||||:||||||
Human   168 RDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTK 232

  Fly   272 WRRQTAEEREAERQAANRLMLSLQAEAISKGFAP--------PSAPLGSQGGVNGAPLA------ 322
            |:||||...|...:|.|  ..:||....|..|.|        |.|.|....|.:..|.|      
Human   233 WKRQTAVGLELLAEAGN--YSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLV 295

  Fly   323 ---ALHGLQPWAE 332
               .:||||..:|
Human   296 PRILIHGLQGASE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 55/143 (38%)
Homeobox 220..273 CDD:278475 31/55 (56%)
BARHL1NP_064448.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 25/94 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..184 22/93 (24%)
Homeobox 182..235 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.