DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and barx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:216 Identity:61/216 - (28%)
Similarity:95/216 - (43%) Gaps:47/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANST---- 142
            :..|.|...|::..:.||        ...::.......:|:|  .||.     ...:::.|    
Zfish     1 MQHPLEIGAHYYPPDAHL--------DQRSHRYRSFMIEEIL--TDHP-----DQKVSSPTGDLL 50

  Fly   143 -YGSAAALYSYP---HLYPSAAGGHVLRVPPQRTPLTWAL-PPLHHAALAHQAVKDRLAAAFPIA 202
             :|..|.|.:.|   ||...|....:|:.|.  :||:.:| .||..|.|:.       ||...:.
Zfish    51 KFGVHALLSARPYHNHLVLKADQTGILKFPV--SPLSCSLGAPLSSALLSG-------AAGLQVG 106

  Fly   203 RRIGH-----PYQNRTPP---------KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARG 253
            ....|     ..:.:..|         |.::.||.||.:|:..|||||.|||||::.:|..||..
Zfish   107 SSSHHLPLDLHLRGKLDPGADAVSKTKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAES 171

  Fly   254 LKMTDAQVKTWFQNRRTKWRR 274
            |.::..|||||:||||.||::
Zfish   172 LGLSQLQVKTWYQNRRMKWKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 35/93 (38%)
Homeobox 220..273 CDD:278475 29/52 (56%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.