DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and npm1b

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_005173145.2 Gene:npm1b / 553507 ZFINID:ZDB-GENE-080723-7 Length:316 Species:Danio rerio


Alignment Length:234 Identity:44/234 - (18%)
Similarity:75/234 - (32%) Gaps:87/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SHEEDDHEHENEHG----------EEVEEQEIHVDVDSDSRMSCGSGSDVDMDGGSCYDESETPL 57
            |.:||:.|.||...          .:|.::::.:|.|.|.    .|..|.|.|.....||.|...
Zfish   137 SDDEDEEEEENNTSPVKRPSNMTLAKVPQKKLKMDSDEDE----DSDDDDDDDDDDDDDEEEDDD 197

  Fly    58 SESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKEL 122
            .:...:.::...|::..|                     ....|:...:.|.:..:|..|:.:..
Zfish   198 KQEKPAVKSPVKSTQKTP---------------------EKKKSADKQNGSPDKKAGTSGKPQTQ 241

  Fly   123 LQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALA 187
            ..|:..|                           .||||      |..:||   ::|.|      
Zfish   242 TPQKVKD---------------------------KSAAG------PSGKTP---SIPSL------ 264

  Fly   188 HQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTR 226
             ..||.:|.:    |.:.|.|:     ||.::...:|.|
Zfish   265 -SEVKSKLTS----AAKEGKPF-----PKTEQKFENFAR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 7/31 (23%)
Homeobox 220..273 CDD:278475 2/7 (29%)
npm1bXP_005173145.2 Nucleoplasmin 32..131 CDD:308605
NPM1-C 265..313 CDD:318505 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.