DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and barhl1b

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:342 Identity:94/342 - (27%)
Similarity:129/342 - (37%) Gaps:90/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNN 95
            ||.:|...||.|...|.|...|..:||..|.:|:.....||...|                    
Zfish    13 DSLLSHRPGSPVISKGDSLVGECRSPLEFSPRSDLESGCSSPPSP-------------------- 57

  Fly    96 NNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAA 160
                               .:...::..|::.|.|||     .::..:|..:| .|.|.   :.|
Zfish    58 -------------------RRECVEDAAQRQGHPLAY-----ASHLQHGPISA-GSQPR---TVA 94

  Fly   161 GGHVLR-VPPQRTPLTWALP------PLHHAALAHQAVKDRLAAAFPIARRIGHPYQ-------- 210
            ...::| :.....||....|      |...|......:.|.|.............|:        
Zfish    95 SSFLIRDILADCKPLAACAPYSSNGQPTQEAGRLASKIADDLIEKIHSNSSSDSEYKVKEEGDRE 159

  Fly   211 ---NRTPP-----KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQN 267
               :|..|     |.:|.||:||..|:|:||:.|.:||||:..:|..||..|.:||.|||||:||
Zfish   160 ISSSRDSPQVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQN 224

  Fly   268 RRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAP--------PSAPLGSQGGVNGAPLA-- 322
            |||||:||||...|...:|.|  ..:||....|..|.|        |.|.|....|.:..|.|  
Zfish   225 RRTKWKRQTAVGLELLAEAGN--YSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQ 287

  Fly   323 -------ALHGLQPWAE 332
                   .|||||..:|
Zfish   288 RPLVPRILLHGLQGASE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 51/142 (36%)
Homeobox 220..273 CDD:278475 30/52 (58%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 10/84 (12%)
Homeobox 178..230 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.