DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and tlx3

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001015902.1 Gene:tlx3 / 548656 XenbaseID:XB-GENE-495044 Length:292 Species:Xenopus tropicalis


Alignment Length:287 Identity:131/287 - (45%)
Similarity:166/287 - (57%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ETSHHHHNNN---NHLLSSSPGSSSNNNNSGE--KGEEKELLQQEDHDLAYKLATSIANSTYGSA 146
            :|.|.|...:   :.:||||...:|:.:::..  :|.|...|..         ..|..::.|.:.
 Frog     8 QTQHQHEPISFGIDQILSSSDQENSSQSSAAAAVRGSEGSYLGS---------PVSRCSAPYSAL 63

  Fly   147 AALYSYPHL---------YP---SAAGGHVLRVPPQRTPLTWALPPLHHAAL------------- 186
            :|  |:|.:         |.   |.|...|:|||..| |:..|:||...:|:             
 Frog    64 SA--SFPGIGATFDESGSYSVNLSLAPAGVIRVPAHR-PIPGAVPPPISSAIPAMPAVPGLGSLN 125

  Fly   187 ------AHQAVKDRLAAA-----FPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQK 240
                  :.:.||:||.||     |.:.||||||||||||||||||||||:|:|:.|||||||:||
 Frog   126 FPWMESSRRFVKERLTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQK 190

  Fly   241 YLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAP 305
            |||||||||||:.||||||||||||||||||||||||||||||||.||||||.||.:|..|..:.
 Frog   191 YLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMLQLQHDAFQKSLSD 255

  Fly   306 PSAPLGSQGGVNGAPLAALHGLQPWAE 332
            ...|  ....::.:.|.||..||||.|
 Frog   256 SIQP--DPLCLHNSSLFALQNLQPWDE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 90/123 (73%)
Homeobox 220..273 CDD:278475 45/52 (87%)
tlx3NP_001015902.1 Homeobox 170..224 CDD:365835 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6169
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3650
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm47612
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5132
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.