DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Barhl1

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_062319.1 Gene:Barhl1 / 54422 MGIID:1859288 Length:327 Species:Mus musculus


Alignment Length:103 Identity:25/103 - (24%)
Similarity:44/103 - (42%) Gaps:27/103 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  2240 GHTAGYSHHQPSSFRLRSDSETLSDEPLLESNDEGIGTDHLDEKIEEGEIRSAKELELYLGKELI 2304
            ||.||.|.....:    .||..||.|.||:       |::|      .|.::::|.:|       
Mouse    87 GHQAGPSAKSSQT----GDSSLLSLEQLLK-------TENL------AEAKASEEDKL------- 127

  Fly  2305 QTGQDILSQESLSMSQLQLPAIVIQSDAGYEKPSPVSS 2342
               :.::.|.||.....:..|::.:|.:|..:..|.:|
Mouse   128 ---KAVMYQSSLCYYSSRAAALLRKSASGGAQGFPAAS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863
Homeodomain 218..274 CDD:459649
Barhl1NP_062319.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 13/66 (20%)
Homeodomain 179..235 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.