DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Lbx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 / 499362 RGDID:1564197 Length:285 Species:Rattus norvegicus


Alignment Length:270 Identity:76/270 - (28%)
Similarity:113/270 - (41%) Gaps:72/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EQTRSSSSENL-----------PFSISRLLSKPFETSHHHHNNNNHLLSS----SPGSSSNNNNS 113
            |:.|.|..::|           ||||..:|:||.....:......|||::    :||        
  Rat    13 EERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPG-------- 69

  Fly   114 GEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWAL 178
            |.....:.||.|.....|.:   .:|:.|:.....              .||:....|..:|   
  Rat    70 GLPLAGRALLSQTSPLCALE---ELASKTFKGLEV--------------SVLQAAEGRDGMT--- 114

  Fly   179 PPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLA 243
                                     ..|   |.:||.||:|.||:||..|:.||||||..||||:
  Rat   115 -------------------------IFG---QRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLS 151

  Fly   244 SAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSA 308
            .|:|..:|:.|.:|:|||.|||||||.|.:|. .||.:|:.::|.:|..|.|.:.::......::
  Rat   152 PADRDQIAQQLGLTNAQVITWFQNRRAKLKRD-LEEMKADVESAKKLGPSGQMDIVALAELEQNS 215

  Fly   309 PLGSQGGVNG 318
            .....||..|
  Rat   216 EASGGGGGGG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 46/118 (39%)
Homeobox 220..273 CDD:278475 31/52 (60%)
Lbx1NP_001040573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 4/22 (18%)
Homeobox 128..181 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..285 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.