DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Tlx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001102636.1 Gene:Tlx1 / 499361 RGDID:1563655 Length:333 Species:Rattus norvegicus


Alignment Length:318 Identity:132/318 - (41%)
Similarity:152/318 - (47%) Gaps:99/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLS 101
            |.|......||:|   |..||:.|.                                 |.|..|:
  Rat    81 GPGGPAGGGGGAC---SMGPLAGSY---------------------------------NVNMALA 109

  Fly   102 SSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLR 166
            ..||.......:|.                            |.|.||        ||||  |:|
  Rat   110 GGPGPGGGGGGAGA----------------------------GGAGAL--------SAAG--VIR 136

  Fly   167 VPPQR---------TPLTWALPPLHHAALAHQAVKDRLAAAFPIA---------RRIGHPYQNRT 213
            ||..|         .||...||.: .:..|...|.:.....||..         |..||||||||
  Rat   137 VPAHRPLAGAVAHPQPLATGLPTV-PSVPAVPGVNNLTGLTFPWMESNRRYTKDRFTGHPYQNRT 200

  Fly   214 PPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAE 278
            |||:|||||||||:|:.|||||||:|||||||||||||:.|||||||||||||||||||||||||
  Rat   201 PPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAE 265

  Fly   279 EREAERQAANRLMLSLQAEAISKGFAP--PSAPLGSQGGVNGAPLAALHGLQPWAEAS 334
            |||||||.|||::|.||.||..|..|.  |:.||    .|:.:.|.||..||||::.|
  Rat   266 EREAERQQANRILLQLQQEAFQKSLAQPLPADPL----CVHNSSLFALQNLQPWSDDS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 89/129 (69%)
Homeobox 220..273 CDD:278475 46/52 (88%)
Tlx1NP_001102636.1 Homeobox 207..260 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6110
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3708
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391465at2759
OrthoFinder 1 1.000 - - FOG0001097
OrthoInspector 1 1.000 - - otm44573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45921
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1533
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.