DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and hoxa1

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:133 Identity:34/133 - (25%)
Similarity:53/133 - (39%) Gaps:41/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KLEELPAAGRAFHFQSHRNTTLWLHRAPLFSLQYRLVDYCYNMTLRDQNGTVRLRPGSAPLDCYF 165
            ||.:|.|......::.|.|.:.:|   |:.              :.::.|.|    .:...|||.
 Frog   295 KLWDLRATKCVTQYEGHVNNSAYL---PVH--------------VNEEEGVV----AAVGQDCYT 338

  Fly   166 RI-HLPYGYRVALQLLTNGPSTLNDSREEAIAIALGT-VGEQDGGNAEYLAPIRCSSTGGMLVAV 228
            || .|.:|:     |||..||....|..:..::|..: :|...|      ||       |:|:||
 Frog   339 RIWSLRHGH-----LLTTIPSPYPASENDIPSVAFSSRLGGFRG------AP-------GLLMAV 385

  Fly   229 YED 231
            .||
 Frog   386 RED 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 11/37 (30%)
Homeodomain 218..274 CDD:459649 6/14 (43%)
hoxa1NP_001008017.1 Homeodomain 221..274 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.