DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and lbl

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:257 Identity:76/257 - (29%)
Similarity:105/257 - (40%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSSENLPFSISRLLSKPFETSH---HHHNNNNHLLSSSPGS------SSNNNNSGE-----KGEE 119
            |..:.|.:...|.|.:.|:...   .....|..:::|..||      ||::|.|.|     :.|:
  Fly   122 SYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEK 186

  Fly   120 KELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYP---SAAGGHVLRVPPQRTPLTWALPPL 181
            .|...|||.....|.:                 |...|   |.:.|.        |||.      
  Fly   187 VEKRSQEDRMEVPKKS-----------------PEEQPKGASKSSGD--------TPLD------ 220

  Fly   182 HHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRK-KPRTSFTRIQVAELEKRFHKQKYLASA 245
               ||...:.|:......|....|   :..|:.||:| |.||:||..|:.||||||..||||:.|
  Fly   221 ---ALFQLSTKNFDEEQDPATLNI---FATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPA 279

  Fly   246 ERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPS 307
            :|..:|.||.:::|||.|||||||.|.:|...|           |...:|.|.|....|.|:
  Fly   280 DRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE-----------LKKDVQCEKIPDQSADPN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 46/113 (41%)
Homeobox 220..273 CDD:278475 31/52 (60%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 55/156 (35%)
Homeobox 254..307 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.