DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and MEOX1

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:69 Identity:31/69 - (44%)
Similarity:41/69 - (59%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QNRTPP----KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRT 270
            :||..|    |.:|.||:||:.|:.|||..|....||....|..:|..|.:::.|||.||||||.
Human   160 ENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRM 224

  Fly   271 KWRR 274
            ||:|
Human   225 KWKR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 31/69 (45%)
Homeodomain 218..274 CDD:459649 26/55 (47%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 7/17 (41%)
Homeodomain 172..228 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 1/2 (50%)

Return to query results.
Submit another query.