DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and ventx1.2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:79 Identity:34/79 - (43%)
Similarity:51/79 - (64%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QNRTPPKRKKP--------RTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQ 266
            :|.|..:.|.|        ||:||..|:..||:.|:||:||.::||..||..|::::.|||||||
 Frog   112 ENDTEHRSKSPKSDLQRRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQ 176

  Fly   267 NRRTKWRRQTAEER 280
            |||.|.:||..:::
 Frog   177 NRRMKLKRQIQDQQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 34/79 (43%)
Homeobox 220..273 CDD:278475 29/60 (48%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 4/16 (25%)
Homeobox 131..183 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.