DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and NKX1-2

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:238 Identity:69/238 - (28%)
Similarity:93/238 - (39%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SSSPGSSSNNNNSGEKGEEKELLQQED------HDLAYKLATSIANSTYGSAAALYSYPHLYPSA 159
            ::.||:...:...|.:.||:|  ..||      .:.|.:|...:|.|....|.||.|....  ..
Human    73 AAGPGAGQASPLEGSEAEEEE--DAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPC--ED 133

  Fly   160 AGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKP---R 221
            .||..:|.||                            ..|.:.|   |.:.|..|...||   |
Human   134 GGGGPVRSPP----------------------------GSPGSPR---PRRRRLEPNCAKPRRAR 167

  Fly   222 TSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQA 286
            |:||..|:..||.:|...:||:..||..||..|.:|:.|||.|||||||||::|......|    
Human   168 TAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGA---- 228

  Fly   287 ANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAP----LAALH 325
                     |:.......|.:|..|..||..|:|    ..|||
Human   229 ---------AQVGGGAPQPGAAGGGGGGGSGGSPGPPGTGALH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 41/121 (34%)
Homeobox 220..273 CDD:278475 28/55 (51%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 28/126 (22%)
Homeobox 167..219 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.