DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Dbx

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:324 Identity:87/324 - (26%)
Similarity:118/324 - (36%) Gaps:104/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SHEEDDHEHENEHGEEVEEQEIHVDVDSDSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTR 67
            :|:...|:|   |.::...|:.|                   .|.||            |.:...
  Fly   248 THQLPPHQH---HQQQQHVQQQH-------------------PGNSC------------QPQTAS 278

  Fly    68 SSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQ---QEDHD 129
            ||||.....|.|               :|||..|::.|:.|...|||:.....||..   .||..
  Fly   279 SSSSPGSTISDS---------------DNNHGASTANGNGSGTGNSGQDARPHELANSNPDEDSS 328

  Fly   130 LAYKLATSI--------ANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALP------- 179
            .:.:|....        |..|.|.....:.:.|..|          ||...|...|.|       
  Fly   329 ASRRLTQDKQQQQQLLGAGGTGGGGGGGHGHGHPTP----------PPPPPPPVIAKPMPSRPTP 383

  Fly   180 --------PLHHAALAH-----QAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTS------FT 225
                    |..|:.|||     .:|.   |..||:....|.|:.:.|   |.|||..      |:
  Fly   384 FLPHTLNHPHLHSLLAHCRNPYMSVG---AQVFPLPPGQGFPWAHST---RGKPRRGMMRRAVFS 442

  Fly   226 RIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANR 289
            ..|...|||||.:|||::..:|..||..|.:.|:|||.||||||.|||  .::|||......:|
  Fly   443 DSQRKGLEKRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWR--NSKERELLASGGSR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 41/100 (41%)
Homeobox 220..273 CDD:278475 27/58 (47%)
DbxNP_647677.2 Homeobox 437..490 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.