DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and Hlx

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001071142.1 Gene:Hlx / 364069 RGDID:1311961 Length:476 Species:Rattus norvegicus


Alignment Length:293 Identity:69/293 - (23%)
Similarity:103/293 - (35%) Gaps:99/293 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLSESLQ------------SEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSS 108
            |.:.|||            |....:.||::|.|.|.|:||..|:......|....|.|...|.  
  Rat   141 PRAGSLQPPTSGTRVVPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGG-- 203

  Fly   109 NNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTP 173
                                                             ...|.|:..:.|....
  Rat   204 -------------------------------------------------RPTGVHLAGLQPSAGQ 219

  Fly   174 LTWALPPLHHAALAHQAVKDRLAAAFPIA----RRIGHPYQNRTPP--------------KRKK- 219
            ...:|.|:..|:          |...|::    ..:.|.:|:..|.              |||: 
  Rat   220 FFASLDPISEAS----------AILSPLSSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRS 274

  Fly   220 -PRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWR--RQTAEERE 281
             .|..|:.:|...|||||..|||:...:|..||..|.:||||||.||||||.|||  ::...:::
  Rat   275 WSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKD 339

  Fly   282 AERQAANRLMLSLQAEAISKGFAPPSAPLGSQG 314
            .:::|..:....:.||    |.....:|..|:|
  Rat   340 KDKEAGEKPSGGVPAE----GEREERSPSRSEG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 45/141 (32%)
Homeobox 220..273 CDD:278475 28/52 (54%)
HlxNP_001071142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..170 7/28 (25%)
COG5576 224..>341 CDD:227863 41/126 (33%)
Homeobox 276..330 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..401 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.