DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and hlx1

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_009293289.1 Gene:hlx1 / 327096 ZFINID:ZDB-GENE-030131-5304 Length:357 Species:Danio rerio


Alignment Length:227 Identity:67/227 - (29%)
Similarity:96/227 - (42%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKL 134
            :|::|.|.|.|:||..||                           .|.:|...|:    ||    
Zfish   106 TSKDLKFGIDRILSTDFE---------------------------PKSKESPSLR----DL---- 135

  Fly   135 ATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAF 199
             |||.:....||..:.:.|:.         ..:.|..:..:..:..:.:|  |.|:.:.:....|
Zfish   136 -TSIVSPNRQSAVHVSASPYF---------ASIDPTMSETSSLMGSIGNA--ARQSGQHQFQDTF 188

  Fly   200 PIARRIGHPY---QNRTPP---KRKK--PRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKM 256
            |     |.||   ...|.|   |||:  .|..|:.:|...|||||..|||:...:|..||..|.:
Zfish   189 P-----GRPYAVLSKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGL 248

  Fly   257 TDAQVKTWFQNRRTKWRR----QTAEEREAER 284
            ||||||.||||||.|||.    |..:::|.|:
Zfish   249 TDAQVKVWFQNRRMKWRHSKEAQAQKDKEKEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 43/101 (43%)
Homeobox 220..273 CDD:278475 28/52 (54%)
hlx1XP_009293289.1 Homeobox 212..265 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.