DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and HOXD13

DIOPT Version :10

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_000514.2 Gene:HOXD13 / 3239 HGNCID:5136 Length:343 Species:Homo sapiens


Alignment Length:54 Identity:18/54 - (33%)
Similarity:32/54 - (59%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 KKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 271
            :|.|..:|::|:.|||..:...|::...:|..::....:::.||..||||||.|
Human   277 RKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 18/54 (33%)
Homeodomain 218..274 CDD:459649 18/54 (33%)
HOXD13NP_000514.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
polyalanine repeat 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115
HoxA13_N <100..172 CDD:463521
Homeodomain 277..333 CDD:459649 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.