DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C15 and HLX

DIOPT Version :9

Sequence 1:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_068777.1 Gene:HLX / 3142 HGNCID:4978 Length:488 Species:Homo sapiens


Alignment Length:270 Identity:67/270 - (24%)
Similarity:98/270 - (36%) Gaps:92/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKL 134
            ||::|.|.|.|:||..|:......|....|.|...|.                            
Human   170 SSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGG---------------------------- 206

  Fly   135 ATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAAL--------AHQAV 191
                                   ..||.|:..:.|.......:|.|::.|:.        ...:|
Human   207 -----------------------RPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSV 248

  Fly   192 KDRLAAAFPIARRIGHPY---QNRTPP---KRKK--PRTSFTRIQVAELEKRFHKQKYLASAERA 248
            :.:....||      .||   ...|.|   |||:  .|..|:.:|...|||||..|||:...:|.
Human   249 QHQFQDTFP------GPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRK 307

  Fly   249 ALARGLKMTDAQVKTWFQNRRTKWR--RQTAEEREAERQAANRLMLSLQAEAISKGFAPPS---- 307
            .||..|.:||||||.||||||.|||  ::...:::.:::|..:          ..|.||.:    
Human   308 QLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEK----------PSGGAPAADGEQ 362

  Fly   308 ---APLGSQG 314
               :|..|:|
Human   363 DERSPSRSEG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C15NP_476873.2 COG5576 <196..315 CDD:227863 46/136 (34%)
Homeobox 220..273 CDD:278475 28/52 (54%)
HLXNP_068777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..173 2/2 (100%)
Abdominal-A 227..>344 CDD:332641 43/122 (35%)
Homeobox 279..332 CDD:306543 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..488 9/52 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.